PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G35240.1
Common NameARF20, T9I1.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARF
Protein Properties Length: 590aa    MW: 66969.6 Da    PI: 7.7075
Description auxin response factor 20
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G35240.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.64.9e-23126223199
                  EEEE-..-HHHHTT-EE--HHH.HTT....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeeh....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                  f kvlt sd+++ g + +pkk+a e+     ++    ++l  +d++g++W+++++yr++++r+ lt+GW+eF  +++L  gD++vF   + +++el+v
  AT1G35240.1 126 FTKVLTASDTSAYGGFFVPKKHAIEClpplPLP---AQELLAKDLHGNQWRFRHSYRGTPQRHSLTTGWNEFTTSKKLVKGDVIVFV--RGETGELRV 218
                  89************************9965444...348************************************************..449999*** PP

                  EEE-S CS
           B3  95 kvfrk 99 
                  +++r+
  AT1G35240.1 219 GIRRA 223
                  ***97 PP

2Auxin_resp103.23.3e-34248329183
   Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                  a ha++++++F vvY+P+  +s+F+v+++k+++a+++k++vG+Rf m+fe++d+serr+ Gt++gv+d++p +W+ S+WrsL+
  AT1G35240.1 248 AKHALDNQCIFIVVYKPSIRSSQFIVSYDKFLDAMNNKFIVGSRFTMRFEGDDFSERRYFGTIIGVNDFSP-HWKCSEWRSLE 329
                  689********************************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.6E-35116234IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.32E-28123243IPR015300DNA-binding pseudobarrel domain
CDDcd100173.91E-22125222No hitNo description
PROSITE profilePS5086313.521126224IPR003340B3 DNA binding domain
PfamPF023625.8E-21126223IPR003340B3 DNA binding domain
SMARTSM010191.9E-22126224IPR003340B3 DNA binding domain
PfamPF065076.5E-29248328IPR010525Auxin response factor
PfamPF023092.6E-6493531IPR033389AUX/IAA domain
SuperFamilySSF542771.08E-9494571No hitNo description
PROSITE profilePS5174524.637495576IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 590 aa     Download sequence    Send to blast
METGNVVNAQ PELSGIIDGS KSYMYEQLWK LCAGPLCDIP KLGENVYYFP QGNIELVDAS  60
TREELNELQP ICDLPSKLQC RVIAIHLKVE NNSDETYAEI TLMPDTTQVV IPTQSENQFR  120
PLVNSFTKVL TASDTSAYGG FFVPKKHAIE CLPPLPLPAQ ELLAKDLHGN QWRFRHSYRG  180
TPQRHSLTTG WNEFTTSKKL VKGDVIVFVR GETGELRVGI RRARHQQGNI PSSIVSIDCM  240
RHGVIASAKH ALDNQCIFIV VYKPSIRSSQ FIVSYDKFLD AMNNKFIVGS RFTMRFEGDD  300
FSERRYFGTI IGVNDFSPHW KCSEWRSLEV QWDEFASFSR PNKVSPWEIE HLMSALNVPR  360
SSLLKNKRLR EVNEFGQEIG QLSVASPMNT SLRYRDTTED AMNPSRLLMS YPVQPMPKLN  420
YNNQMVTQIE ENITTKAVTN FRLFGVSLAI PLVIKDPIEE IGSDISKLTE GKKFGQSQTL  480
RSPIEIQSKQ FGSTRTCTKV QMQGVTIGRA VDLSVLNGYD QLILELEKLF DLKGQLQTRN  540
QWKIAFTDSD GYEMLVGDDP WPEFCKMVKK ILIYSKEEVK NLKSSKSLSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-11413541357Auxin response factor 1
4ldw_A1e-11413541357Auxin response factor 1
4ldw_B1e-11413541357Auxin response factor 1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO793571480.0
Genevisible261163_x_at0.0
Expression AtlasAT1G35240-
AtGenExpressAT1G35240-
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G35240.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9C7I9
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G35240
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6697950.0AY669795.1 Arabidopsis thaliana clone C00610 ARF20 (At1g35240) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_174758.20.0auxin response factor 20
SwissprotQ9C7I90.0ARFT_ARATH; Auxin response factor 20
TrEMBLC0SUZ10.0C0SUZ1_ARATH; Auxin response factor (Fragment)
STRINGAT1G35240.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12276731
Representative plantOGRP5261578
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Hagen G,Guilfoyle T
    Auxin-responsive gene expression: genes, promoters and regulatory factors.
    Plant Mol. Biol., 2002 Jun-Jul. 49(3-4): p. 373-85
    [PMID:12036261]
  3. Cluis CP,Mouchel CF,Hardtke CS
    The Arabidopsis transcription factor HY5 integrates light and hormone signaling pathways.
    Plant J., 2004. 38(2): p. 332-47
    [PMID:15078335]
  4. Remington DL,Vision TJ,Guilfoyle TJ,Reed JW
    Contrasting modes of diversification in the Aux/IAA and ARF gene families.
    Plant Physiol., 2004. 135(3): p. 1738-52
    [PMID:15247399]
  5. Okushima Y, et al.
    Functional genomic analysis of the AUXIN RESPONSE FACTOR gene family members in Arabidopsis thaliana: unique and overlapping functions of ARF7 and ARF19.
    Plant Cell, 2005. 17(2): p. 444-63
    [PMID:15659631]
  6. Hoen DR, et al.
    Transposon-mediated expansion and diversification of a family of ULP-like genes.
    Mol. Biol. Evol., 2006. 23(6): p. 1254-68
    [PMID:16581939]
  7. Axtell MJ,Snyder JA,Bartel DP
    Common functions for diverse small RNAs of land plants.
    Plant Cell, 2007. 19(6): p. 1750-69
    [PMID:17601824]
  8. Swaminathan K,Peterson K,Jack T
    The plant B3 superfamily.
    Trends Plant Sci., 2008. 13(12): p. 647-55
    [PMID:18986826]
  9. Ikeda M,Ohme-Takagi M
    A novel group of transcriptional repressors in Arabidopsis.
    Plant Cell Physiol., 2009. 50(5): p. 970-5
    [PMID:19324928]
  10. Varaud E, et al.
    AUXIN RESPONSE FACTOR8 regulates Arabidopsis petal growth by interacting with the bHLH transcription factor BIGPETALp.
    Plant Cell, 2011. 23(3): p. 973-83
    [PMID:21421811]
  11. Vernoux T, et al.
    The auxin signalling network translates dynamic input into robust patterning at the shoot apex.
    Mol. Syst. Biol., 2011. 7: p. 508
    [PMID:21734647]
  12. Wang J,Yan DW,Yuan TT,Gao X,Lu YT
    A gain-of-function mutation in IAA8 alters Arabidopsis floral organ development by change of jasmonic acid level.
    Plant Mol. Biol., 2013. 82(1-2): p. 71-83
    [PMID:23483289]
  13. Piya S,Shrestha SK,Binder B,Stewart CN,Hewezi T
    Protein-protein interaction and gene co-expression maps of ARFs and Aux/IAAs in Arabidopsis.
    Front Plant Sci, 2014. 5: p. 744
    [PMID:25566309]